bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8606_orf2 Length=82 Score E Sequences producing significant alignments: (Bits) Value CE24934 26.9 8.8 Hs9961250 26.9 9.2 Hs4505771 26.9 9.2 Hs9961252 26.9 9.3 > CE24934 Length=492 Score = 26.9 bits (58), Expect = 8.8, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 0/39 (0%) Query 30 CAELSVHLNAQQQQTVENAKNGILRRPLNAEFNSSVAKK 68 C E+ ++ ++ Q + NAKNG + P+++ SS+ K+ Sbjct 110 CFEVGMNPDSVQNERDRNAKNGGMGGPMSSPTQSSLCKE 148 > Hs9961250 Length=1286 Score = 26.9 bits (58), Expect = 9.2, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query 45 VENAKNGILRRPLNAE--FNSSVAKKKKKKNFET 76 +E AKNG RP +AE F ++ K+K+K +T Sbjct 3 LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKT 36 > Hs4505771 Length=1279 Score = 26.9 bits (58), Expect = 9.2, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query 45 VENAKNGILRRPLNAE--FNSSVAKKKKKKNFET 76 +E AKNG RP +AE F ++ K+K+K +T Sbjct 3 LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKT 36 > Hs9961252 Length=1232 Score = 26.9 bits (58), Expect = 9.3, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query 45 VENAKNGILRRPLNAE--FNSSVAKKKKKKNFET 76 +E AKNG RP +AE F ++ K+K+K +T Sbjct 3 LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKT 36 Lambda K H 0.321 0.128 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1159278568 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40