bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8583_orf1 Length=107 Score E Sequences producing significant alignments: (Bits) Value 7298751 29.3 1.9 7292930 28.9 2.3 7294182 28.9 2.7 YOR030w 28.5 2.9 Hs20357556 28.5 3.0 Hs20357552 28.5 3.3 7290439 28.1 3.9 At5g16270 27.7 5.1 Hs20536136 27.7 5.2 7297289 27.7 5.8 Hs22061329 27.3 7.2 CE07710 27.3 7.7 At2g27440 26.9 9.1 7291782_2 26.9 9.4 > 7298751 Length=1097 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Query 15 NSKKKPKRNTKLKSQRSCRRSKSRQR---FQKRRRRKRRKKAKNATKSSLE 62 + ++K + + K Q R RQR +K +RKR +AK A + LE Sbjct 371 DKREKARLEAERKQQEELERQLQRQREIEMEKEEQRKRELEAKEAARKELE 421 > 7292930 Length=392 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 0/24 (0%) Query 75 CTYMYYHCEFKLKKMHYANYVQQP 98 CT + HC F L+ ++Y + V QP Sbjct 319 CTRYWQHCGFSLQLLNYPDAVNQP 342 > 7294182 Length=921 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query 2 QNKKSKIKTNPELNSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKKAKNATKSSL 61 ++ + +IK EL+ K + KR+ +L+ + R +KSR R + + K + +AK ++ + Sbjct 778 KDVRGQIKFLEELD-KAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEM 836 Query 62 E 62 E Sbjct 837 E 837 > YOR030w Length=619 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 6/58 (10%) Query 5 KSKIKTNPELNSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKKAKNATKSSLE 62 ++K NP SK K NTK SK RQ +K RR+ + KN + E Sbjct 524 ENKFGQNPSFGSKSNGKPNTKTT------LSKYRQLLRKPRRKTNSYEPKNGIGQNKE 575 > Hs20357556 Length=513 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Query 3 NKKSKIKTNPE-LNSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKKAKNATKS 59 +K S I+ N E L +K+ + K +++R+ R +K RQ Q+ RRK ++A+ T++ Sbjct 308 SKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQE-QEEARRKLEEQARAKTQT 364 > Hs20357552 Length=550 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Query 3 NKKSKIKTNPE-LNSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKKAKNATKS 59 +K S I+ N E L +K+ + K +++R+ R +K RQ Q+ RRK ++A+ T++ Sbjct 345 SKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQE-QEEARRKLEEQARAKTQT 401 > 7290439 Length=373 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 0/37 (0%) Query 15 NSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRK 51 N+KK + K + +++ R+ K RQR Q+R R+++ K Sbjct 235 NAKKIEQHRLKQERRQAERKIKERQRDQRRARKEQEK 271 > At5g16270 Length=1021 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 1 DQNKKSKIKTNPELNSKKKPKRNTKLKSQRSCRRS 35 D N + IK++ ELN+ + PKR L S+ + S Sbjct 267 DLNAEEGIKSSGELNANEMPKRGEDLSSEYNAPES 301 > Hs20536136 Length=1036 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 0/54 (0%) Query 13 ELNSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKKAKNATKSSLELIIF 66 EL +K+K R+ + + R+ + KS++ KRR ++ ++ + + L ++IF Sbjct 431 ELRTKEKELRSREEELTRAALQQKSQEELLKRREQQLAEREIDVLERELNILIF 484 > 7297289 Length=333 Score = 27.7 bits (60), Expect = 5.8, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 0/51 (0%) Query 2 QNKKSKIKTNPELNSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKK 52 Q ++SK+KT E N+++ + K + +R +K + K+R R R++K Sbjct 32 QKERSKLKTAREKNAERLKLQGVKWERERLQHAAKEAELLAKKRERHRQQK 82 > Hs22061329 Length=836 Score = 27.3 bits (59), Expect = 7.2, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 43 KRRRRKRRKKAKNATKSSLELIIFTFCTCACLC 75 K+ +K R+KA + S + +++F F C +C Sbjct 188 KKLSQKGRQKAHSTCSSHITVVVFFFVPCIFMC 220 > CE07710 Length=1973 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 7/63 (11%) Query 27 KSQRSCRRS---KSRQRFQKRRRRKRRKKAKNATKSSLELIIFTFCTCACLCTYMYYHCE 83 K+ R C++S K+R F + N+ K S IF +C C C ++ Sbjct 1171 KTPRECQKSHIPKTRASFSNNAEFN----SPNSDKYSNHFQIFQIRSCLCACFVLFIFFN 1226 Query 84 FKL 86 FK+ Sbjct 1227 FKI 1229 > At2g27440 Length=368 Score = 26.9 bits (58), Expect = 9.1, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 7/70 (10%) Query 2 QNKKSKIKTNPELNSKKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKKAKNATKSSL 61 +N+ S K + E K+K ++N K +S+R ++ + RRR + + ++ + +S+ Sbjct 10 ENRASLAKASAERFGKRKIQQNLKDRSER-------HKQIARVRRRGKPELSRFGSSASV 62 Query 62 ELIIFTFCTC 71 I+F C Sbjct 63 GRIVFELSRC 72 > 7291782_2 Length=775 Score = 26.9 bits (58), Expect = 9.4, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 17 KKKPKRNTKLKSQRSCRRSKSRQRFQKRRRRKRRKKAKNATKSSLEL 63 +KK + ++ S RS +R +SR+R R + + AT+ +L+L Sbjct 422 RKKQRTSSSATSGRSGKRDQSRERSTSSTARPKPPLRRTATEETLDL 468 Lambda K H 0.320 0.127 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40