bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8567_orf4 Length=116 Score E Sequences producing significant alignments: (Bits) Value 7290471 29.3 1.7 7302184 27.7 6.0 Hs4502995 26.9 8.6 > 7290471 Length=815 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Query 4 AAPRRPAAASAASNSPQFAASAGSTAAKTGTWGAFRRSLCSA 45 ++PRRP+ AS ++ S F + + +AA TW ++ R C+A Sbjct 756 SSPRRPSWASQSAVSSCFCSWSTYSAASPSTWASWPR--CAA 795 > 7302184 Length=881 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 5/62 (8%) Query 33 GTWGAFRRSLCSA----CR-GRSSAAGILCRRIKQQVKPRLLFAANALPGCPAPNDECHW 87 G G FRRS+ + C+ GR+ + RR Q+ + + A P C P ++C Sbjct 286 GCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAM 345 Query 88 GR 89 R Sbjct 346 KR 347 > Hs4502995 Length=415 Score = 26.9 bits (58), Expect = 8.6, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 0/21 (0%) Query 27 STAAKTGTWGAFRRSLCSACR 47 S A ++G WGA R S S+C+ Sbjct 142 SKATRSGNWGALRASWASSCQ 162 Lambda K H 0.319 0.130 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174970866 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40