bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8567_orf1 Length=186 Score E Sequences producing significant alignments: (Bits) Value YNL091w 33.1 0.37 7298751 32.3 0.54 At3g57300 30.8 1.4 CE08354 29.6 3.7 > YNL091w Length=1240 Score = 33.1 bits (74), Expect = 0.37, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 25/34 (73%), Gaps = 0/34 (0%) Query 12 RKISKRRRKRLESRKQEQQRQQQQQQQQQSEREQ 45 +K+ + +RK+ E RK+ + QQ++++ Q+ +R+Q Sbjct 694 KKVEEAKRKKDEERKRRLEEQQRREEMQEKQRKQ 727 > 7298751 Length=1097 Score = 32.3 bits (72), Expect = 0.54, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 27/37 (72%), Gaps = 3/37 (8%) Query 16 KRRRKRLESRKQEQQ---RQQQQQQQQQSEREQQRGR 49 KR + RLE+ +++Q+ RQ Q+Q++ + E+E+QR R Sbjct 372 KREKARLEAERKQQEELERQLQRQREIEMEKEEQRKR 408 > At3g57300 Length=1496 Score = 30.8 bits (68), Expect = 1.4, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 33/50 (66%), Gaps = 5/50 (10%) Query 1 RQIFLHLIFVWRKISKRRRKRLESRKQEQQRQQ---QQQQQQQSEREQQR 47 R+I ++ W++ K+ + E +KQE++ + ++Q+Q++S+R+QQR Sbjct 407 RKISRDMLLFWKRYDKQMAE--ERKKQEKEAAEAFKREQEQRESKRQQQR 454 > CE08354 Length=663 Score = 29.6 bits (65), Expect = 3.7, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query 3 IFLHLIFVWRKISKRRRKRLESRKQEQQRQQQQQQQQQSE 42 +F IF W +SKRRR+ + S+K ++ ++ Q + E Sbjct 503 LFFSKIF-WIMVSKRRRQYMYSKKTHEKEKEHQLDEAVKE 541 Lambda K H 0.323 0.135 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3022542264 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40