bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8463_orf1 Length=54 Score E Sequences producing significant alignments: (Bits) Value At1g55050 29.6 1.3 At4g29090 27.3 7.1 > At1g55050 Length=914 Score = 29.6 bits (65), Expect = 1.3, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 8 RGKPLPHAAAAAAAKDFWNAKNEKGRTSVLRNEERSA 44 R +PL A A DF+ K++K TS RN ERSA Sbjct 790 RKRPLTTRALEALESDFFTPKSKKTTTSKPRNRERSA 826 > At4g29090 Length=575 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query 2 NRDAFERGKPLPHAAAAAAAKDFWNAKNEK-GRTSVLRNEE 41 NR + R +P PH WN NE+ G VLRNE+ Sbjct 413 NRSSCGRWRPPPHQWVKCNTDATWNRDNERCGIGWVLRNEK 453 Lambda K H 0.309 0.123 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1200194442 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40