bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8418_orf1 Length=71 Score E Sequences producing significant alignments: (Bits) Value At3g55480_2 30.0 1.0 YER035w 27.7 4.8 > At3g55480_2 Length=1113 Score = 30.0 bits (66), Expect = 1.0, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query 14 YGKSTLQRPEPRVRTNARTAFATTWKLHVTLRLSPARSSVLAYKPAIWLCRCTMHQL 70 Y + L P P VR A A +LHV L+ A S A PA+++ RC + L Sbjct 86 YFQKDLGDPNPLVRAWALRTMAGI-RLHVIAPLALAAVSKCARDPAVYVRRCAANAL 141 > YER035w Length=145 Score = 27.7 bits (60), Expect = 4.8, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query 12 PLYGKSTLQRPEPRVRTNARTAFATTWKLHVTLRLS 47 P +GKST QR EPR RT ++T VT+ + Sbjct 47 PNFGKSTKQRREPRERT-SKTGHEDDKATMVTVNID 81 Lambda K H 0.328 0.135 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194057928 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40