bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8249_orf1 Length=62 Score E Sequences producing significant alignments: (Bits) Value 7299865 29.6 1.5 Hs14916451 28.1 4.0 > 7299865 Length=3085 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 0/54 (0%) Query 4 VYLTQKKPPKVSFPAAAAAAAAAAAAALAKSPPAPQLSFSFLPGLPAARQQQQQ 57 V +T K PP A A AA + + K PP PQ+ LP +Q Q Q Sbjct 2782 VMVTAKIPPVTQIKRTNAQAKAAGISGVGKVPPQPQVVNKVLPTSIVTQQSQVQ 2835 > Hs14916451 Length=395 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 0/43 (0%) Query 13 KVSFPAAAAAAAAAAAAALAKSPPAPQLSFSFLPGLPAARQQQ 55 K + PA A + A+ PPAP+ SF+ +P + A +++ Sbjct 196 KSNVPADEAVQVTDSTIPEAEIPPAPEESFTTIPDITALEEEK 238 Lambda K H 0.315 0.123 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40