bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8195_orf5 Length=129 Score E Sequences producing significant alignments: (Bits) Value Hs8923510 28.5 3.1 Hs11545773 28.5 3.2 Hs15431293 28.1 4.6 Hs20556105 27.7 5.2 Hs17865805 26.9 9.6 Hs15147254 26.9 9.6 > Hs8923510 Length=774 Score = 28.5 bits (62), Expect = 3.1, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Query 74 WLLLPTAATPAAAAAAAAAAAPCCCAHSMGDYGGSHQLQAGSSGSST 120 WL LP A+TPA A ++ A +P +M GG Q+ AGS G +T Sbjct 514 WLGLPPASTPAPALPSSPAWSPPATEATM---GGKRQV-AGSVGGNT 556 > Hs11545773 Length=772 Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust. Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Query 4 PATVQIGGAAAHSLHSGSSSKRVSDLLLLLLAAACVLQQLLLLLLAPHPGAPGKAL---- 59 P V + G L G +S+R +LL L+ + LL P P APG AL Sbjct 603 PILVAVTGILVQLLVRGPASEREQATSVLLADPCFQLRSICYLLGQPEPPAPGTALPAPD 662 Query 60 -KRFS 63 KRFS Sbjct 663 RKRFS 667 > Hs15431293 Length=204 Score = 28.1 bits (61), Expect = 4.6, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Query 23 SKRVSDLLLLLLAAAC-VLQQLLLLLLAPHPGAPGKALK 60 K+ SD++ LL C +QL L AP P P KA + Sbjct 12 RKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARR 50 > Hs20556105 Length=186 Score = 27.7 bits (60), Expect = 5.2, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Query 23 SKRVSDLLLLLLAAAC-VLQQLLLLLLAPHPGAPGKALK 60 K+ SD++ LL C +QL L AP P P KA + Sbjct 12 RKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARR 50 > Hs17865805 Length=924 Score = 26.9 bits (58), Expect = 9.6, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Query 14 AHSLHSGSSSKRVSDLLLLLLAAACVLQQLLLLLLAPHPGAPGKALKRFSKANTWYSAQL 73 H + + S L + A C+ +LL PH G + A TW L Sbjct 848 GQEFHVSAGTLAFSVTLFTIFAFVCI--SVLLYRRRPHLGGELGGPRGCKLATTWLFVSL 905 Query 74 WLLLPTAATPAA 85 WLL AT A Sbjct 906 WLLYILFATLEA 917 > Hs15147254 Length=925 Score = 26.9 bits (58), Expect = 9.6, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Query 14 AHSLHSGSSSKRVSDLLLLLLAAACVLQQLLLLLLAPHPGAPGKALKRFSKANTWYSAQL 73 H + + S L + A C+ +LL PH G + A TW L Sbjct 849 GQEFHVSAGTLAFSVTLFTIFAFVCI--SVLLYRRRPHLGGELGGPRGCKLATTWLFVSL 906 Query 74 WLLLPTAATPAA 85 WLL AT A Sbjct 907 WLLYILFATLEA 918 Lambda K H 0.317 0.125 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1209785478 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40