bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8195_orf4 Length=120 Score E Sequences producing significant alignments: (Bits) Value Hs14730213 30.4 0.84 Hs20542824 28.1 4.0 Hs4505963 27.7 5.0 Hs6005812 27.7 6.0 At2g13790 27.3 7.6 > Hs14730213 Length=1572 Score = 30.4 bits (67), Expect = 0.84, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 9/49 (18%) Query 13 CSALAAQRQQQQESFGPATAAAGCCMCFAAAVAAAAGPTSGGPWEGPQK 61 CS+L + R + +F G C AA PTS GP EG Q+ Sbjct 660 CSSLESARFPETPAFSSQEEEDGAC---------AAEPTSSGPAEGSQE 699 > Hs20542824 Length=228 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query 11 GGCSALAAQRQQQQESFGP-ATAAAGCCMCFAAAVAAAAGPTSGGPWEGPQKI 62 G C LAA R + ++FG A+ CMCF A + GP E + I Sbjct 141 GLCLGLAASRLVRCKAFGTCASHLIVVCMCFGATICTYLGPQLASSAEEEKMI 193 > Hs4505963 Length=361 Score = 27.7 bits (60), Expect = 5.0, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 45 AAAAGPTSGGPWEGPQKILKSEHLVFCPA 73 A +AG G P+ PQK+L+S++L P+ Sbjct 20 ADSAGMQQGSPFRNPQKLLQSDYLQGVPS 48 > Hs6005812 Length=482 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query 63 LKSEHLVFCPAVAAAANSSNPCCSSSSSCCCCA 95 LK+ +L + P+ + +A S N CS S+SCC A Sbjct 53 LKAANLTYMPSSSGSARSLNCGCS-SASCCTVA 84 > At2g13790 Length=520 Score = 27.3 bits (59), Expect = 7.6, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 0/27 (0%) Query 69 VFCPAVAAAANSSNPCCSSSSSCCCCA 95 V C +NS CC S+S CC + Sbjct 138 VSCRGANDCSNSRGSCCRCSTSICCSS 164 Lambda K H 0.323 0.130 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1160968786 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40