bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8195_orf2 Length=104 Score E Sequences producing significant alignments: (Bits) Value YKL209c 27.3 6.2 CE28232 27.3 6.9 > YKL209c Length=1290 Score = 27.3 bits (59), Expect = 6.2, Method: Compositional matrix adjust. Identities = 22/95 (23%), Positives = 35/95 (36%), Gaps = 5/95 (5%) Query 3 MLCAQQQGAAAAAAAAAAAGVAAVGSSSHSWAEYQVFAFENLLRAFPGAPGCGASSSSN- 61 +L + A G+A G + H + + + +NL A+P AP + N Sbjct 1018 ILDEKHNTLEVENNNARTVGIA--GHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNF 1075 Query 62 --SCCKTHAAASSSSSRSETLLLLLPLCSECAAAP 94 C +T S + TL+LLL C Sbjct 1076 DMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGK 1110 > CE28232 Length=1283 Score = 27.3 bits (59), Expect = 6.9, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Query 31 HSWAEYQVFAFENLLRAFPGAPGCGASSSSNSCCKTHAAASSSSS 75 HSW E +VF + +L + GC SS+ C A+ +SSSS Sbjct 138 HSWGEVEVFMCQLVLPSVKEHAGCFKSSADPRC---DASKTSSSS 179 Lambda K H 0.315 0.120 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174332180 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40