bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8040_orf2 Length=112 Score E Sequences producing significant alignments: (Bits) Value 7290317 32.0 0.27 Hs17437651_1 29.6 1.6 At4g05500 28.9 2.4 CE21890 28.9 2.5 YBR140c 28.5 3.5 7303627 27.7 5.5 > 7290317 Length=1385 Score = 32.0 bits (71), Expect = 0.27, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query 59 AQEFGNICCKPTFGAHRPFDVEQLFLMLLAEAASTEEA--IAQVVVLVVDACAA 110 A+E G + +P FG R VE+L + ++ ST EA + V+ D+ A Sbjct 166 AKENGGLSARPNFGGKRLSGVEELSMSATSDIYSTSEAEGVTSVIKATDDSVGA 219 > Hs17437651_1 Length=276 Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query 7 PSLPGVATRVASSEIVSTILSALGHW--DPSLWLQVGVGSREERRPFQG 53 P G T SE ++ + S L H+ +PSL + GS+EERR QG Sbjct 31 PPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQG 79 > At4g05500 Length=449 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 7/57 (12%) Query 3 WLLLPS--LPGVATRVASSEIVSTILSALGHW-----DPSLWLQVGVGSREERRPFQ 52 W LPS + R+ + EI+ W DPS+W ++ + +R +R F+ Sbjct 181 WAELPSKLTSSILLRLGAIEILQNAQKVCKPWHRVCKDPSMWRKIDIDNRNDRAAFK 237 > CE21890 Length=198 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 8 SLPGVA-TRVASSEIVSTILSALGHWDPSL 36 S PG+A R+ ++ +V+ +ALGHW SL Sbjct 85 SSPGIADKRIVAANVVTVAKNALGHWKHSL 114 > YBR140c Length=3092 Score = 28.5 bits (62), Expect = 3.5, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 0/46 (0%) Query 2 PWLLLPSLPGVATRVASSEIVSTILSALGHWDPSLWLQVGVGSREE 47 P++ L G+ V E + T++ +L +W P+L+ V + + EE Sbjct 2404 PYIWKYMLDGLENDVIPQEHIPTVVCSLSYWVPNLYEHVYLANDEE 2449 > 7303627 Length=322 Score = 27.7 bits (60), Expect = 5.5, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query 51 FQGFTPGDAQEFGNICCKPTFGAHRPFDVEQLFLMLLAEAASTEEA 96 + G PG+ +FG K T+ A R +V + L +L E A+ + A Sbjct 277 YAGHVPGETYKFGRTYAKTTYDAKRWLEVHK-NLTVLPEVANLDYA 321 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1188972946 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40