bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8008_orf3 Length=62 Score E Sequences producing significant alignments: (Bits) Value Hs13514809 29.6 1.3 Hs13514813 29.6 1.3 Hs22055158 28.1 4.4 Hs4503509 26.9 9.2 > Hs13514809 Length=660 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 19/39 (48%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Query 18 LTYCFVW--KAADCLE-FLSSERYGCTRASGAAQERERE 53 LT FV K AD LE FL E Y CT G +R+RE Sbjct 441 LTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE 479 > Hs13514813 Length=662 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 19/39 (48%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Query 18 LTYCFVW--KAADCLE-FLSSERYGCTRASGAAQERERE 53 LT FV K AD LE FL E Y CT G +R+RE Sbjct 443 LTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE 481 > Hs22055158 Length=1514 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 0/19 (0%) Query 44 SGAAQEREREREREREREV 62 S + QERERE+E RER++ Sbjct 1272 SKSTQEREREKEPSRERDI 1290 > Hs4503509 Length=1382 Score = 26.9 bits (58), Expect = 9.2, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 36 ERYGCTRASGAAQERERERERERERE 61 E +G R S ++ERE +RE+ER+R+ Sbjct 1187 ESWGPPRESRPSEEREWDREKERDRD 1212 Lambda K H 0.325 0.134 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40