bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8008_orf2 Length=62 Score E Sequences producing significant alignments: (Bits) Value Hs4504877 28.1 4.7 Hs4503627 26.9 8.7 CE06615 26.9 8.8 Hs9961353 26.9 9.1 > Hs4504877 Length=638 Score = 28.1 bits (61), Expect = 4.7, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query 23 AAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTF 59 + FGG+EL V+ + VCQ C +C+FFT+ Sbjct 298 PGVDFGGEELN-VTFVKGVNVCQETCTKMIRCQFFTY 333 > Hs4503627 Length=625 Score = 26.9 bits (58), Expect = 8.7, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 27 FGGKELQTVSGLPHETVCQFACELNKKCKFFTF 59 F G+EL V+ HE CQ C +C+FFT+ Sbjct 301 FLGEELDIVAAKSHE-ACQKLCTNAVRCQFFTY 332 > CE06615 Length=277 Score = 26.9 bits (58), Expect = 8.8, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Query 14 LLGCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTF 59 LLGC C + ++L+ H +C + CE KCK+ F Sbjct 4 LLGCLDCVQTEAYNTLEDLEAHIASDHLNICPYECE---KCKYAKF 46 > Hs9961353 Length=571 Score = 26.9 bits (58), Expect = 9.1, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 27 FGGKELQTVSGLPHETVCQFACELNKKCKFFTF 59 F G+EL V+ HE CQ C +C+FFT+ Sbjct 247 FLGEELDIVAAKSHE-ACQKLCTNAVRCQFFTY 278 Lambda K H 0.326 0.136 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40