bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8005_orf2 Length=123 Score E Sequences producing significant alignments: (Bits) Value CE16546 30.0 1.2 At1g19110 29.6 1.4 SPBC8D2.20c 28.9 2.5 CE03053 28.5 3.0 Hs20149711 28.1 3.8 Hs18555231 28.1 4.5 At1g32530 27.3 6.9 > CE16546 Length=630 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 0/53 (0%) Query 6 RCCLAVCCSSSSSSFFLFFCSSRSSSVCCCCCFQLLQRAVVEGRLVQYEEQQL 58 +C VC S +++F+ S+S S C C +L R V +E Q+ Sbjct 301 QCWERVCIYSRNTNFYQLLFFSKSRSYCVCGLHSMLSRQTVYHVNEMFENQKF 353 > At1g19110 Length=759 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 9/14 (64%), Positives = 9/14 (64%), Gaps = 0/14 (0%) Query 1 CCCCFRCCLAVCCS 14 C CF CC VCCS Sbjct 742 CIACFECCSTVCCS 755 > SPBC8D2.20c Length=1224 Score = 28.9 bits (63), Expect = 2.5, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 84 RSSNSPRLYFENPKAAVAAASSNINP 109 R S+SP + NP +A ASS +NP Sbjct 971 RISSSPNMPPSNPYTPIAVASSTVNP 996 > CE03053 Length=473 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 7/16 (43%), Positives = 11/16 (68%), Gaps = 0/16 (0%) Query 61 CSCSKNRQSGVKCCCC 76 C+C+++ G CCCC Sbjct 44 CTCTEHHMGGTICCCC 59 > Hs20149711 Length=245 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Query 64 SKNRQSGVKCCCCYL--LLQQHRSSNSPRLYFENPKAAVAAA-SSNINPCC 111 SKN + V+C L L+++ N PR+Y+ N K + + +S+++PC Sbjct 157 SKNWRLSVRCGGWPLRRLMEEGSLPNPPRIYYRNKKRILKSQNNSSVDPCM 207 > Hs18555231 Length=140 Score = 28.1 bits (61), Expect = 4.5, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 25 CSSRSSSVCCCCCFQLLQRAVVEGRLVQYEEQQ 57 +R V C C +L A+VEG ++QY Q+ Sbjct 1 MEARDKQVLCLLCLKLGAEALVEGLVLQYLYQE 33 > At1g32530 Length=711 Score = 27.3 bits (59), Expect = 6.9, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query 7 CCLAVCCSSSSSSFFLFFCSSRSSSVCCCCCFQLLQRAV 45 C V C S S SFF ++ S V C CC L+Q+ + Sbjct 668 CAHQVVCGSCSDSFFA--SNNGGSKVTCPCCRGLVQQRI 704 Lambda K H 0.331 0.133 0.481 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1191192512 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40