bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7958_orf1 Length=123 Score E Sequences producing significant alignments: (Bits) Value At2g10110 27.3 6.3 Hs22053518 27.3 7.1 7294003 26.9 9.0 > At2g10110 Length=169 Score = 27.3 bits (59), Expect = 6.3, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 11/73 (15%) Query 55 SNGKCSSNIII---------SNSSIISSSSSITSSSTAAVAAEASANEGPTPPQRMAEAF 105 S KCS III S+S+II S+S +++S + S + +R + Sbjct 57 STNKCSITIIIHSTNHSTTKSSSTIIHHSTSYSTASLRVFSIPHSTRQSSIRKKRRLQ-- 114 Query 106 QNRGPLQGPPRGA 118 Q P+ GPPR + Sbjct 115 QITRPITGPPRSS 127 > Hs22053518 Length=171 Score = 27.3 bits (59), Expect = 7.1, Method: Compositional matrix adjust. Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 0/51 (0%) Query 62 NIIISNSSIISSSSSITSSSTAAVAAEASANEGPTPPQRMAEAFQNRGPLQ 112 NI+I S I S + S +AN+GP PP + F G L+ Sbjct 28 NIVIQPLSYIVSHYTRVSVPLLETCISPAANQGPAPPHSLTADFSGYGCLE 78 > 7294003 Length=550 Score = 26.9 bits (58), Expect = 9.0, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query 92 NEGPTPPQRMAEAFQNRGPLQ-GPPRGAP 119 EG +P +M FQ+ P+Q PPRG P Sbjct 493 REGDSPETQMPRPFQHTQPMQAAPPRGPP 521 Lambda K H 0.307 0.119 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1191192512 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40