bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7907_orf5 Length=71 Score E Sequences producing significant alignments: (Bits) Value At4g35680_1 29.3 2.1 7300114 28.5 2.8 > At4g35680_1 Length=325 Score = 29.3 bits (64), Expect = 2.1, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Query 43 PPPPEPSFLPFRVFFSLLPIPACEPSL 69 PPPP P+ F+ LL IP PSL Sbjct 210 PPPPSPAI--FKTTIGLLSIPFVSPSL 234 > 7300114 Length=670 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 0/41 (0%) Query 18 LPRVGERPPGVQQLLESTATQEPAPPPPPEPSFLPFRVFFS 58 +PR + PP +ES A + AP P P V FS Sbjct 456 VPRAVQSPPEATTSVESKAVEADAPDPSASGHVNPLLVVFS 496 Lambda K H 0.317 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194057928 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40