bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7907_orf1 Length=71 Score E Sequences producing significant alignments: (Bits) Value 7300758 33.1 0.13 CE27132 31.6 0.35 CE27131_2 31.6 0.35 Hs19882229_1 27.7 6.0 Hs4885333 27.3 7.9 > 7300758 Length=1742 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Query 15 KKTRNGRNEGSGGGGGAGSCVAVDSRSCCTPGGLSPTRGRRSCGLSP 61 +K++NG ++ S G GA A+DS + G +P+R RR L P Sbjct 1049 RKSKNGSSDKSDGAEGA----ALDSNAIPNGGATNPSRRRRDVALEP 1091 > CE27132 Length=620 Score = 31.6 bits (70), Expect = 0.35, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 16 KTRNGRNEGSGGGGGAGSCVAVDSRSCCTPGGLSPTRGRRS 56 + R+ +NE SG G G+CV+ D GG+ P +R+ Sbjct 133 EIRDPKNEASGSGDKEGNCVSSDPAPAYLNGGVLPLGAQRA 173 > CE27131_2 Length=601 Score = 31.6 bits (70), Expect = 0.35, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 16 KTRNGRNEGSGGGGGAGSCVAVDSRSCCTPGGLSPTRGRRS 56 + R+ +NE SG G G+CV+ D GG+ P +R+ Sbjct 114 EIRDPKNEASGSGDKEGNCVSSDPAPAYLNGGVLPLGAQRA 154 > Hs19882229_1 Length=387 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query 27 GGGGAGSCVAVDSRSCCTPGGLSPTRGRRSCG 58 GG GAG C D R+ PG +P+ G C Sbjct 10 GGDGAGDCAHPDPRA---PGAAAPSSGPGPCA 38 > Hs4885333 Length=330 Score = 27.3 bits (59), Expect = 7.9, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query 2 RSDGSHAGIGRREKKTRNGRNEGSGGGGGAG 32 R+ GS +GRR K T G NE G G G G Sbjct 292 RNQGSSL-LGRRGKDTAEGTNEDRGVGQGEG 321 Lambda K H 0.319 0.138 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194057928 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40