bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7686_orf2 Length=158 Score E Sequences producing significant alignments: (Bits) Value 7301861 33.1 0.26 7293294 31.6 0.64 7300323 28.1 6.4 > 7301861 Length=1275 Score = 33.1 bits (74), Expect = 0.26, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 7/54 (12%) Query 58 PTCGAAAAAAAAAAAASFPGSSGA-------SRNRDSHSHAPPPAAAAAPAAAA 104 PT GA A AA S PG S ++ D+ AP P +A P AAA Sbjct 1035 PTPGAGAPKPQAAGTISKPGESQKKDAPAPPTKPGDTKPAAPKPGESAKPEAAA 1088 > 7293294 Length=1158 Score = 31.6 bits (70), Expect = 0.64, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query 62 AAAAAAAAAAAASFPGSSGAS-RNRDSHSHAPPPAAAAAPAAAAAWSVLCLLGP 114 AA A +A A++ G GA+ N SH A A AA+PAA +A + GP Sbjct 505 AAGNATLSAKGANYQGHQGAAAENLASHPVARTGATAASPAAKSADAAGPATGP 558 > 7300323 Length=505 Score = 28.1 bits (61), Expect = 6.4, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Query 61 GAAAAAAAAAAAASFPGSSGA---SRNRDSHSHAPPPAAAAAPAAAA 104 A+AA A + A+ P + G+ S +SHSH A A+AP + Sbjct 334 AASAAVPIATSVAAVPTTGGSLPDSPAHESHSHESNSATASAPTTPS 380 Lambda K H 0.329 0.129 0.511 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2100092188 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40