bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7686_orf1 Length=193 Score E Sequences producing significant alignments: (Bits) Value CE05185 30.4 2.3 > CE05185 Length=682 Score = 30.4 bits (67), Expect = 2.3, Method: Composition-based stats. Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 12/98 (12%) Query 43 QRGPRRHKTDQAAAAAGAAAAAGGGACEWESLFRLAPEEPGKEAAAAAA----AAAAAAP 98 QRG +++T A A AGG A L R++ E P + + A A + +P Sbjct 103 QRGASKNQTTALGVTALTLACAGGHADVVRRLIRISNETPRSKQSLAPTPLIVATCSKSP 162 Query 99 QVGEEL--------QLLKNVVLICLADLRDCCIPAVYV 128 Q+ L + +KN+ + + C P VY+ Sbjct 163 QICSYLADFRVNLDESMKNLGNLTALSMAIVCTPGVYM 200 Lambda K H 0.319 0.129 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3228275340 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40