bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7659_orf2 Length=107 Score E Sequences producing significant alignments: (Bits) Value Hs20468653 27.7 5.1 At1g28060 27.3 7.5 > Hs20468653 Length=118 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 21/37 (56%), Gaps = 10/37 (27%) Query 48 AAAPPGPQLPQLPLGRAQRSFQRP---------PRPQ 75 AAPPGP P+L LGR RS +RP PRPQ Sbjct 5 VAAPPGPSGPELFLGRGLRS-RRPGVSENHLDLPRPQ 40 > At1g28060 Length=786 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 27/90 (30%), Positives = 36/90 (40%), Gaps = 11/90 (12%) Query 3 SSGIIFAQTRPHVGWGGGYATGKPQAGSRRGNSACLISFHAAGCRAAAPPGPQLPQLPLG 62 S+G FA T PH G G + +A R A + FH R AP P G Sbjct 280 STGTSFASTLPHTGLAGFGSIANIEAVKRAQELAANMGFHQD--REFAPVINLFP----G 333 Query 63 RAQRSFQRPPRPQEP-----RHLGRQSEAH 87 +A RP++P LGR+ + H Sbjct 334 QAPSDMTVAQRPEKPPVLRVDALGREIDEH 363 Lambda K H 0.317 0.134 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40