bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7659_orf1 Length=194 Score E Sequences producing significant alignments: (Bits) Value CE24078 31.2 1.4 At5g60170_1 28.5 9.5 > CE24078 Length=388 Score = 31.2 bits (69), Expect = 1.4, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 19/46 (41%), Gaps = 0/46 (0%) Query 112 LEPAKPSGRPAWRSEGTVSSQLEGTSSAQTLSRVRWHPYSLRNSNS 157 EP P P W +G+ + Q EG S L V +P R + Sbjct 54 FEPTDPEKLPIWNFDGSSTGQAEGADSDVYLKPVAIYPDPFRQGKN 99 > At5g60170_1 Length=533 Score = 28.5 bits (62), Expect = 9.5, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Query 101 NDTRRAVSAEVLEPAKPSGRPAWRSEGTVSSQLEGTSSAQ-----TLSRVRWHP 149 N ++A+S LE P RP W + SQ++G+S Q TL R HP Sbjct 469 NTDKKAIS---LEDRIPRTRPGWDWISDLQSQMQGSSKLQVEDISTLDSQRPHP 519 Lambda K H 0.316 0.123 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3264145066 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40