bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7632_orf1 Length=70 Score E Sequences producing significant alignments: (Bits) Value At4g08970 30.4 0.95 SPBC776.18c 28.5 2.9 > At4g08970 Length=597 Score = 30.4 bits (67), Expect = 0.95, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 0/49 (0%) Query 13 LHKKCAVHQRRVKRCKFTSAGKIGLCEKCTRVFFTAGARQCLKPVLRRA 61 H CAVH R R KF G L K R F K + RR+ Sbjct 541 FHGACAVHIERNVRLKFPKKGVSNLVRKAARAFNETNYGGLYKEIERRS 589 > SPBC776.18c Length=318 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Query 37 LCEKCTRVFFTAGARQCLKP----VLRRANVR 64 +CE C FT G QC P +LR+A R Sbjct 38 MCESCVDRIFTTGPAQCPTPGCNKILRKAKFR 69 Lambda K H 0.341 0.145 0.493 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197219688 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40