bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7625_orf4 Length=61 Score E Sequences producing significant alignments: (Bits) Value At1g72250 29.3 1.9 > At1g72250 Length=1195 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 0/40 (0%) Query 9 NKSNVVSNCYKKAPVGPTPRKGTQGASYCESTETAYVVAP 48 NK+ S C K+ P P PR+ + + S E Y+ P Sbjct 982 NKTGRFSICAKRIPSAPAPRRSSLAPTTSTSREMVYLTRP 1021 Lambda K H 0.306 0.121 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178852562 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40