bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7625_orf3 Length=51 Score E Sequences producing significant alignments: (Bits) Value CE09031 27.7 4.8 YLR387c 27.3 6.6 > CE09031 Length=426 Score = 27.7 bits (60), Expect = 4.8, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Query 7 NTPQRDA------RSKLLRIDRNCLCCCPCGSGNLSA 37 NT RD + K + I+ C CC P GS N SA Sbjct 311 NTDYRDVFLIYWKKLKRVLIEEYCCCCVPAGSRNYSA 347 > YLR387c Length=432 Score = 27.3 bits (59), Expect = 6.6, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query 16 KLLRIDRNCLCCCPCGSG--NLSANWAGK 42 K++ ID NCLCC GSG ++ A+ A K Sbjct 231 KMIVIDHNCLCCNFHGSGLESIRAHMASK 259 Lambda K H 0.316 0.131 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1161614636 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40