bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7516_orf3 Length=86 Score E Sequences producing significant alignments: (Bits) Value CE27639_3 28.9 2.5 Hs17487390 28.5 3.5 At3g15400 27.3 7.0 > CE27639_3 Length=358 Score = 28.9 bits (63), Expect = 2.5, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Query 4 RASLSSLSG--GTKRESGGCNPNASLHSLRNLPKCSSCS 40 R + L+G G + S CN N L + NLP C CS Sbjct 89 RKVFAMLTGVTGKSKSSFFCNGNFKLRQMANLPICRRCS 127 > Hs17487390 Length=264 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Query 8 SSLSGGTKRESGGCNPNASLHSLRNLPKCSSCSRRPVGARKTLSCDSSPTAEGLRFTTI 66 S L G R+ GGC+P + +L SCS +G+ + S P EG T++ Sbjct 77 SELEHGCSRQGGGCSPQPGVQPSTHLSPPESCS---IGSSVLWALWSHPQREGFGVTSV 132 > At3g15400 Length=416 Score = 27.3 bits (59), Expect = 7.0, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Query 13 GTKRESGGCNPNASLHSLRNLPKCSSCSRRPVGARKTLSCDSSPTAEGLRFTT 65 GT ++GGCNPN + + P C C G K +S D E L T+ Sbjct 362 GTGCQTGGCNPNPPHYYIP--PSCPHCPPFTSGQDKHMS-DKGAMTEALAPTS 411 Lambda K H 0.314 0.126 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1190857334 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40