bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7516_orf2 Length=76 Score E Sequences producing significant alignments: (Bits) Value SPBC18H10.04c 29.3 1.8 CE16437 28.5 3.1 Hs18581169 26.9 8.2 > SPBC18H10.04c Length=388 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 44 SAALAVDGQSVRGKHCLATLRQPRKAFA 71 SAALA+ G+ + G+ T+ +PR++FA Sbjct 147 SAALALSGEDLMGRPVRITVAEPRRSFA 174 > CE16437 Length=529 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 0/49 (0%) Query 13 ERRSHPCLAGLSGNLGAAIQTLPCTLSEICPSAALAVDGQSVRGKHCLA 61 ER H L L ++ + SEI S+A+AV+ Q V GK LA Sbjct 381 ERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEAQKVAGKEALA 429 > Hs18581169 Length=145 Score = 26.9 bits (58), Expect = 8.2, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query 27 LGAAIQTLPCTLSEICPSAALAVDGQSVRGKHCLATLRQPRKAFA 71 LG+A+ +LPC E+ PS +DG S+ + +A L RK+F+ Sbjct 81 LGSALCSLPCGKREVVPSIK-RIDGVSLLVRKTIARL-HLRKSFS 123 Lambda K H 0.324 0.134 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178249128 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40