bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7487_orf4 Length=114 Score E Sequences producing significant alignments: (Bits) Value CE23837 29.3 1.7 CE23836 29.3 1.7 Hs4505799 28.9 2.2 Hs4826710 28.9 2.4 At1g53680 28.1 4.4 Hs21328446 26.9 9.7 HsM4885451 26.9 10.0 > CE23837 Length=283 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 9/104 (8%) Query 15 GSGRKEEREKANKDFLFSFSFSFCCGCINCLFILSICCFPCLFVAAAA---------AAA 65 SG + ++ K ++ +LF+F+++ C N +ICC+ LF + A Sbjct 95 NSGLESDKAKFHELYLFAFNYAKSAACRNLDLETAICCWDVLFGQRSTIMTQWIDFLWAQ 154 Query 66 AAAAAAAAAADIAITAAFASAAAVAAAPAAVLLLQVPLLPLPLL 109 AAA+ A ++ + A + + L LL P L Sbjct 155 ENAAASRLAQNVGASNAKQFKSVWISRDTWNLFWDFILLSKPDL 198 > CE23836 Length=336 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 15 GSGRKEEREKANKDFLFSFSFSFCCGCINCLFILSICCFPCLF 57 SG + ++ K ++ +LF+F+++ C N +ICC+ LF Sbjct 148 NSGLESDKAKFHELYLFAFNYAKSAACRNLDLETAICCWDVLF 190 > Hs4505799 Length=1686 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 5/33 (15%) Query 19 KEEREKANKDFLFSFSFSFCCGCINCLFILSIC 51 +EE EKA+++F++S C GC ++L IC Sbjct 1222 EEEYEKASENFIYS-----CAGCCVATYVLGIC 1249 > Hs4826710 Length=1396 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 0/31 (0%) Query 8 QLNSKAWGSGRKEEREKANKDFLFSFSFSFC 38 + S W EE+++ +++FL F F FC Sbjct 399 EYKSDQWKPPNLEEKKRYDREFLLGFQFIFC 429 > At1g53680 Length=224 Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 12 KAWGSGRKEEREKANKDFLFS 32 K WG+ + EE+EK K+FL S Sbjct 116 KIWGNKKGEEQEKGKKEFLES 136 > Hs21328446 Length=1076 Score = 26.9 bits (58), Expect = 9.7, Method: Compositional matrix adjust. Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 6/81 (7%) Query 35 FSFCCGCINCLFILSICCFPCLFVAAAAA-----AAAAAAAAAAAADIAITAAF-ASAAA 88 F++C +C + S CL +A A AAA I AA+ A+ Sbjct 700 FAYCWAIKHCALLGSTGERICLAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQ 759 Query 89 VAAAPAAVLLLQVPLLPLPLL 109 AA+P+ +L L PLLPL +L Sbjct 760 PAASPSRLLSLMDPLLPLSVL 780 > HsM4885451 Length=1076 Score = 26.9 bits (58), Expect = 10.0, Method: Compositional matrix adjust. Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 6/81 (7%) Query 35 FSFCCGCINCLFILSICCFPCLFVAAAAA------AAAAAAAAAAAADIAITAAFASAAA 88 F++C +C + S CL +A A AAA D + A A+ Sbjct 700 FAYCWAIKHCALLGSTGERICLAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQ 759 Query 89 VAAAPAAVLLLQVPLLPLPLL 109 AA+P+ +L L PLLPL +L Sbjct 760 PAASPSRLLSLMDPLLPLSVL 780 Lambda K H 0.329 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181971906 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40