bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7487_orf1 Length=139 Score E Sequences producing significant alignments: (Bits) Value 7290822 28.5 4.6 Hs14733695 27.7 6.8 > 7290822 Length=1161 Score = 28.5 bits (62), Expect = 4.6, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 0/28 (0%) Query 76 QHKQQQRQREKRHLQQQHSSRSSSNSSC 103 H ++ REK H+Q HSS +S + Sbjct 303 HHPHKKYLREKMHVQMDHSSHVASTVTV 330 > Hs14733695 Length=127 Score = 27.7 bits (60), Expect = 6.8, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Query 55 SSSSNRSNKG--SKRSNLQRRLKQHKQQQRQREKRHLQQQHSSRSSSNSSCRSKSSSNSN 112 S N++NK +K +N QRR +Q ++++++E+RH + SR S + RS++ +N+ Sbjct 56 PSEENKANKNQLAKVTNKQRREQQWMEKKKRQEERHRHKALESRGSHRDNNRSEAEANTQ 115 Query 113 IS 114 ++ Sbjct 116 VT 117 Lambda K H 0.288 0.0984 0.236 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1534984332 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40