bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7287_orf3 Length=84 Score E Sequences producing significant alignments: (Bits) Value YDR169c 30.8 0.68 At3g21430 28.9 2.3 > YDR169c Length=513 Score = 30.8 bits (68), Expect = 0.68, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Query 29 YLLLCTNPNP-ASSKSSSRRLKKQQRRASNDLKLS 62 YL++ TNPN A+S S+S +L++Q +SN + LS Sbjct 365 YLIVTTNPNSKATSVSTSPKLEEQMNVSSNPIVLS 399 > At3g21430 Length=961 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 7/43 (16%) Query 37 NPAS-SKSSSRRLKKQQRRASNDL------KLSSASSLCLRSR 72 +PAS SKSSS R KQ+R SNDL + S +SSL + R Sbjct 245 DPASMSKSSSLRNSKQRRYGSNDLCNPELERKSPSSSLIQKRR 287 Lambda K H 0.324 0.133 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197406694 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40