bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7287_orf2 Length=76 Score E Sequences producing significant alignments: (Bits) Value Hs14589851 32.3 0.20 Hs4557693 27.7 4.9 At3g47250 27.7 5.6 Hs5670342 27.3 6.1 > Hs14589851 Length=411 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 0/71 (0%) Query 6 PALLFTRGAGRSSNSSSSSSSEPVVLQQQQQAREGFRFMILPAAAASFPPVVLPLLPAAA 65 P LL + A ++S S S++P VL + ++ M + F VVL L+ A Sbjct 4 PDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGAT 63 Query 66 AFQAGQQSVEI 76 F+A +Q EI Sbjct 64 VFKALEQPHEI 74 > Hs4557693 Length=298 Score = 27.7 bits (60), Expect = 4.9, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Query 1 DQFPPPALLFTRGAGRSSNSSSSSSSEPVVLQQQQQAREGFRF 43 D FPPP ++ T GAG + N+S S L Q + +E RF Sbjct 243 DAFPPPRVVDTLGAGDTFNASVIFS-----LSQGRSVQEALRF 280 > At3g47250 Length=480 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 6 PALLFTRGAGRSSNSSSSSSSEPVVLQQQQQAREGFRFMI 45 P+ F G+S SSS S+ P++L ++ +G +F + Sbjct 273 PSSKFQHSKGKSGEVSSSESTFPLILSAKRLRLQGIKFRL 312 > Hs5670342 Length=298 Score = 27.3 bits (59), Expect = 6.1, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Query 1 DQFPPPALLFTRGAGRSSNSSSSSSSEPVVLQQQQQAREGFRF 43 D FPPP ++ T GAG + N+S S L Q + +E RF Sbjct 243 DAFPPPRVVDTLGAGDTFNASVIFS-----LSQGRSVQEALRF 280 Lambda K H 0.316 0.128 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178249128 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40