bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7287_orf1 Length=84 Score E Sequences producing significant alignments: (Bits) Value Hs4758898 32.3 0.24 Hs17136080 30.4 0.74 Hs8923057 29.3 1.7 Hs22068725 28.1 4.5 CE00713 27.3 7.0 > Hs4758898 Length=336 Score = 32.3 bits (72), Expect = 0.24, Method: Composition-based stats. Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Query 8 PSLHSRRW--PQQQQQQQQQQRTSGAA 32 PSLHSR W PQQ++ +QQQ +A Sbjct 182 PSLHSRHWGAPQQREGRQQQHHEELSA 208 > Hs17136080 Length=346 Score = 30.4 bits (67), Expect = 0.74, Method: Composition-based stats. Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Query 8 PSLHSRRW--PQQQQQQQQQQRTSGAA 32 PSLHSR W PQQ++ +QQQ +A Sbjct 182 PSLHSRHWGAPQQREGRQQQHHEELSA 208 > Hs8923057 Length=545 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query 2 PVPSPRP---SLHSRRWPQQQQQ-QQQQQRTSGAAAAAASK 38 P PSPR + R W QQ Q+ Q+Q+QR+S SK Sbjct 490 PQPSPRTFSQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSK 530 > Hs22068725 Length=1054 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Query 10 LHSRRWPQQQQQQQQQQRTSGAAAAAASKGGFSFYDFACCCCFFSARCPS--PSSCCCSL 67 L+ R Q+ Q AA A S S YD F A CP P S CS Sbjct 753 LYKGRVNSQRGAQPLAVAKELAAVKAPSPPSQSLYDRVHSSALFGAICPPLCPRSSACSA 812 Query 68 SGGPAIS 74 + GP ++ Sbjct 813 ASGPHLT 819 > CE00713 Length=13055 Score = 27.3 bits (59), Expect = 7.0, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 0/24 (0%) Query 58 PSPSSCCCSLSGGPAISRNLINLI 81 PSPSSC C S G A+ R ++ Sbjct 12878 PSPSSCNCQCSEGKAVLRATCEMV 12901 Lambda K H 0.324 0.132 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197406694 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40