bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7286_orf3 Length=62 Score E Sequences producing significant alignments: (Bits) Value At3g09340 26.9 9.3 > At3g09340 Length=478 Score = 26.9 bits (58), Expect = 9.3, Method: Compositional matrix adjust. Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 5 DKLLPRSSRRRLYARSSNRRSLLPLLLLLLVLLLPFTVLRGS 46 ++L+P S + R Y S +++L L L++ L PF + G+ Sbjct 421 EELMPPSEKMRSYGVSIFIKTILVLSTLVVALTFPFFAIMGA 462 Lambda K H 0.333 0.145 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40