bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7230_orf1 Length=76 Score E Sequences producing significant alignments: (Bits) Value SPAC23D3.06c 28.5 3.3 Hs22065797 27.7 5.1 At5g67290 27.3 7.7 7296485 26.9 8.9 Hs4826874 26.9 9.1 CE24459 26.9 10.0 > SPAC23D3.06c Length=1325 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 0/32 (0%) Query 45 LGAPSTLGGPPSLGGSPSWGPPRVLGGPSVWG 76 G PST G P G ++G V G PS +G Sbjct 518 FGQPSTFGQAPVFGQPSAFGQAPVFGQPSAFG 549 > Hs22065797 Length=897 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Query 52 GGPPSLGGSPSWGPPR-----VLGGPSVWG 76 GGP G P GPP+ + GGP WG Sbjct 812 GGPGPHWGHPMGGPPQAWGHPMQGGPQPWG 841 > At5g67290 Length=406 Score = 27.3 bits (59), Expect = 7.7, Method: Compositional matrix adjust. Identities = 20/76 (26%), Positives = 29/76 (38%), Gaps = 0/76 (0%) Query 1 QQRVPAARAAATAAENAAAATTTAAATLLNVLLQQMRFAAAARTLGAPSTLGGPPSLGGS 60 Q+ VP T+ + A T+ + L ++ A + PST G P +G Sbjct 294 QEEVPDDADQVTSNPESIQVLKRVAKTVSSYLNEENALVKAEQACFLPSTEDGVPVIGEI 353 Query 61 PSWGPPRVLGGPSVWG 76 P V G S WG Sbjct 354 PGIKGCYVGTGHSCWG 369 > 7296485 Length=228 Score = 26.9 bits (58), Expect = 8.9, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query 36 MRFAAAARTLGAPSTLGGPPSLGGSPS--WGPPRVLGGP 72 + F T G P GPPSL +P+ +GPP + GP Sbjct 66 VEFPQPEDTYGPPPETYGPPSLVEAPAEVYGPPDQIYGP 104 > Hs4826874 Length=2090 Score = 26.9 bits (58), Expect = 9.1, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 0/24 (0%) Query 41 AARTLGAPSTLGGPPSLGGSPSWG 64 AA G+P T GG P GG P++G Sbjct 1972 AAPVFGSPPTFGGSPGFGGVPAFG 1995 > CE24459 Length=302 Score = 26.9 bits (58), Expect = 10.0, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 47 APSTLGGPPSLGGSPSWGPPRVLGGP 72 P ++ PP L +P PPRVLG P Sbjct 97 VPPSIFMPPQLRAAPIMFPPRVLGIP 122 Lambda K H 0.313 0.125 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178249128 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40