bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7219_orf6 Length=96 Score E Sequences producing significant alignments: (Bits) Value 7292678 29.3 1.7 Hs22041021 29.3 1.9 At1g52000 28.1 3.7 At4g29050 28.1 4.2 > 7292678 Length=1108 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 9/75 (12%) Query 23 TLLRSQCSYFIAAATPPQQQLGFSGSSRATATPLHIFYLPALPRDYRKS----EVLLLLL 78 ++++ Q AAATPP +GF A++TPL + +PR V++ + Sbjct 605 SIIKDQKQPSSAAATPPPTGMGF-----ASSTPLRHVHPDIIPRQVDSPVSALSVMMRRM 659 Query 79 ALQQQQQPQQQQQSA 93 LQ+ + P+++ + A Sbjct 660 ELQEPETPERETRDA 674 > Hs22041021 Length=746 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query 22 CTLLRSQCSYFIAAATPPQQQ-LGFSGSSRATATPLHIFYLPA 63 C ++ QC+YF A+ +P Q L F R LH PA Sbjct 418 CNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPA 460 > At1g52000 Length=730 Score = 28.1 bits (61), Expect = 3.7, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 0/47 (0%) Query 19 RCWCTLLRSQCSYFIAAATPPQQQLGFSGSSRATATPLHIFYLPALP 65 R + T SYF AA Q +GF GSS + + PA P Sbjct 83 RTYGTYGNKTSSYFSVAAPKDNQIVGFLGSSSHALNSIDAHFAPAPP 129 > At4g29050 Length=669 Score = 28.1 bits (61), Expect = 4.2, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 43 LGFSGSSRATATPLHIFYLPALPRDYRKSEVLLLL 77 LG++ TA+ + I LP LPRD R + V +L Sbjct 254 LGWTFKLNGTASNIDISRLPKLPRDSRSTSVKKIL 288 Lambda K H 0.323 0.132 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1201432980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40