bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7219_orf3 Length=76 Score E Sequences producing significant alignments: (Bits) Value Hs4507157_2 30.8 0.62 Hs19924165 30.8 0.65 Hs20545739 29.3 1.8 7304373 28.9 2.5 7291813 28.5 3.2 Hs13112050 27.3 6.7 Hs13112052 27.3 7.0 > Hs4507157_2 Length=1457 Score = 30.8 bits (68), Expect = 0.62, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Query 36 IRAPQGPPGAPRG-----PRGAEGPLEGHF 60 +R P+G P APR PR AEG + GH+ Sbjct 887 LRTPEGLPDAPRNLQLSLPREAEGVIVGHW 916 > Hs19924165 Length=2347 Score = 30.8 bits (68), Expect = 0.65, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 28 RGPGESCAIRAPQGPPGAPRGPR 50 +GP S ++RAP+ P AP PR Sbjct 1026 KGPKTSLSLRAPETVPSAPENPR 1048 > Hs20545739 Length=189 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Query 30 PGESCAIRAPQGPPGAPRGPRGAEGPLEGHFLGATRYW 67 PG S A AP+ P APR P+ GPL HF+ +W Sbjct 3 PGRSAAPAAPRTEPAAPRSPQPESGPL--HFIEMEFFW 38 > 7304373 Length=1666 Score = 28.9 bits (63), Expect = 2.5, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Query 40 QGPPGAPRGPRGAEGPLEGHFLGATRYWPMTTAWSR 75 +GPP P PRGA G GATR+ + +S+ Sbjct 49 RGPPSTPNAPRGASG-------GATRHVHVQPMYSQ 77 > 7291813 Length=506 Score = 28.5 bits (62), Expect = 3.2, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 17/49 (34%), Gaps = 0/49 (0%) Query 1 LRNRGAARAAVPGKAGQRAGREAAPFRRGPGESCAIRAPQGPPGAPRGP 49 LR +GA A GRE P R P ++ P P P Sbjct 60 LRKKGAPTACTKAAPKASPGRETVPTARSPMPDMSLLTKSKPAAGPTSP 108 > Hs13112050 Length=762 Score = 27.3 bits (59), Expect = 6.7, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 0/30 (0%) Query 37 RAPQGPPGAPRGPRGAEGPLEGHFLGATRY 66 R P GP +P GPR +EGPL L + Y Sbjct 525 RRPPGPDLSPDGPRSSEGPLSFPVLVSCAY 554 > Hs13112052 Length=802 Score = 27.3 bits (59), Expect = 7.0, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 0/30 (0%) Query 37 RAPQGPPGAPRGPRGAEGPLEGHFLGATRY 66 R P GP +P GPR +EGPL L + Y Sbjct 565 RRPPGPDLSPDGPRSSEGPLSFPVLVSCAY 594 Lambda K H 0.318 0.137 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178249128 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40