bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7219_orf1 Length=86 Score E Sequences producing significant alignments: (Bits) Value Hs22043058 36.2 0.016 CE09790 32.3 0.20 7299744 28.5 3.2 Hs4758028_2 27.7 5.3 CE25898 27.3 8.0 > Hs22043058 Length=3631 Score = 36.2 bits (82), Expect = 0.016, Method: Composition-based stats. Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 7/78 (8%) Query 4 KKKNSSPTTATTPSSLASTASPPKSDPPGAPRRPAGLWGPRGAPAARGSRS-----FPRG 58 K + P + +P S + + PG P R +G G +G+P++RGSR P G Sbjct 2403 KGEKGDPGSQGSPGSRGAPGQYGEKGFPGDPGR-SGQKGVQGSPSSRGSRGEPGNPGPTG 2461 Query 59 RAGTEPPPAP-RAAPLSP 75 G E P R+ PLSP Sbjct 2462 TLGAEGLQGPQRSGPLSP 2479 > CE09790 Length=1153 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 4 KKKNSSPTTATTPSSLASTASPPKS 28 KK S PTTAT P+++A+ +PP+S Sbjct 1121 KKPPSRPTTATRPTAVAARTAPPRS 1145 > 7299744 Length=988 Score = 28.5 bits (62), Expect = 3.2, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query 20 ASTASPPKSDPPGAPRRPAGLWGPRGAPAARGSRSFPRGRAGTEPP 65 STASP + PG+ P P G+ A+ GS P A T P Sbjct 66 GSTASPGSTAEPGSTAEPGSTAEP-GSTASPGSTVTPGSTASTSEP 110 > Hs4758028_2 Length=539 Score = 27.7 bits (60), Expect = 5.3, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Query 39 GLWGPRGAPAARGS-----RSFPRGRAGTEPPPAPRAAPLSPGPR 78 G+ GPRG+ ARG+ R+ P GR G P P+ +PGPR Sbjct 167 GISGPRGSGGARGAPGERGRTGPLGRKGEPGEPGPKGGIGNPGPR 211 > CE25898 Length=586 Score = 27.3 bits (59), Expect = 8.0, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 20 ASTASPPKSDPPGAPRRPAGLWGPRGAP 47 +ST++PPK+ GAP+RP+ PR AP Sbjct 380 SSTSAPPKTTAAGAPKRPSSAVAPRRAP 407 Lambda K H 0.308 0.128 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1190857334 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40