bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7184_orf6 Length=66 Score E Sequences producing significant alignments: (Bits) Value At5g49970_1 30.0 1.0 YIL095w 29.3 1.7 Hs22069680 28.1 4.3 YDR350c 26.9 8.5 > At5g49970_1 Length=309 Score = 30.0 bits (66), Expect = 1.0, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query 17 LLHRKTGNDGSKQRLQKHHILNPLLLP-GWQIHRRNHERQGQRPCM 61 L+ R +Q LQKH ++ + +P GW + +HE G +P M Sbjct 214 LIRRLVSLQNYEQTLQKHPVIVSVDIPSGWHVEEGDHEDGGIKPDM 259 > YIL095w Length=810 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query 20 RKTGNDGSKQRLQKHHILNPLLLPGWQIHRRNHERQGQR 58 RK +D QRL+K + P +L + H RN+ R G R Sbjct 598 RKEESD-KNQRLEKRRSMPPSILSDFDQHERNNSRTGSR 635 > Hs22069680 Length=1051 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 35 HILNPLLLPGWQIHRRNHERQGQRPCMACP 64 H+LN L LP + N ++ G+RP ++ P Sbjct 280 HLLNRLFLPLYVYSLENQDKGGERPKISLP 309 > YDR350c Length=611 Score = 26.9 bits (58), Expect = 8.5, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 6 KIFMEGLLLVLLLHRKTGNDGSKQRLQKHHILNPLLL 42 K+F++ LL L H +G DG+KQ+ ++ N LL Sbjct 250 KVFIQALLQKLEQHCYSGKDGAKQKNLRYVKFNNTLL 286 Lambda K H 0.324 0.142 0.466 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1163608362 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40