bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7184_orf2 Length=58 Score E Sequences producing significant alignments: (Bits) Value CE20203 29.3 1.8 CE28747 28.1 4.3 > CE20203 Length=343 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query 2 RPFTGVLIDPLFLQSCWPSRAPEGLLGLQDTGSPELLLLP 41 RP T V+I PL L C+P+ +GL +D E ++ P Sbjct 113 RPCTQVMILPLNLH-CFPNTLKKGLFATRDILEGEFIIAP 151 > CE28747 Length=1158 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Query 4 FTGVLIDPLFLQSCWPSRAPEGLLGLQDTG---SPELLLLPTWLCCCCCSIG 52 F G+ +P+F W + +L +Q G S L L W+ C CC +G Sbjct 962 FKGIFTNPIFC-VIWITTLISHILIVQFGGQWFSTAPLDLTQWIICICCGVG 1012 Lambda K H 0.326 0.146 0.535 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187999082 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40