bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_7005_orf3 Length=136 Score E Sequences producing significant alignments: (Bits) Value Hs20534359 28.5 3.5 At2g19860 28.1 4.7 > Hs20534359 Length=1140 Score = 28.5 bits (62), Expect = 3.5, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 57 KRSFEVQKSSFLSFVGDESSKVCCSVLLLQVAQLGEGVAAAKQLLLL 103 K S E K + L + +E+S + SV++L A + +GV K+L L Sbjct 217 KDSSEEDKKATLQVINEENSFLNNSVMILTYALMNDGVTGLKELAFL 263 > At2g19860 Length=502 Score = 28.1 bits (61), Expect = 4.7, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Query 51 GLFEGFKRSFEVQKSSFLSFVGDESSKVCCSVLLLQVAQLGEGVAAA--KQLLLLLVDCS 108 GLFE + + E KSS +GDE S+ +L + +G + AA Q L L D Sbjct 441 GLFEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELEDDSE 500 Query 109 TS 110 TS Sbjct 501 TS 502 Lambda K H 0.325 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1425342594 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40