bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6931_orf4 Length=57 Score E Sequences producing significant alignments: (Bits) Value SPAC16E8.14c 26.9 9.8 > SPAC16E8.14c Length=219 Score = 26.9 bits (58), Expect = 9.8, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Query 2 YRLNCCEF---DGIICVRLNAFRRQEQWDKIVSSLT 34 Y CCE G+ICV+ N ++ +D I SS+T Sbjct 141 YLSRCCEAIQEKGVICVKENVSSFEDTFDPIDSSVT 176 Lambda K H 0.329 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1191047922 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40