bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6931_orf3 Length=70 Score E Sequences producing significant alignments: (Bits) Value 7301349 30.0 1.1 CE24782 28.9 2.4 > 7301349 Length=432 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 7/43 (16%) Query 14 GAVGQNRIISHRLDFHS---SSKLGCFWH-CGIWHYRAMRLRA 52 G+ G +R + H +DF++ S + GCFWH C H+RA L A Sbjct 305 GSYGFDRPVGH-VDFYANWGSQQPGCFWHECS--HWRAFMLFA 344 > CE24782 Length=2094 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query 8 ECVPQTGA-VGQNRIISHRLDFHSSSKLGCFWHCGI 42 +C+ Q A V Q+++I+H LD H S G +HC + Sbjct 1950 QCLKQFPADVNQDQVIAHILDTHGMSMHGNTFHCNL 1985 Lambda K H 0.333 0.141 0.506 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197219688 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40