bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6827_orf1 Length=53 Score E Sequences producing significant alignments: (Bits) Value At5g62060 28.1 4.5 At3g18440 27.7 5.7 At3g22550 27.3 7.4 > At5g62060 Length=303 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 0/25 (0%) Query 3 SFFILINPLEESWQLCGAPGRTASC 27 SFFI +PL + +L PG T C Sbjct 100 SFFIFTHPLNTNQELVSIPGLTVDC 124 > At3g18440 Length=598 Score = 27.7 bits (60), Expect = 5.7, Method: Composition-based stats. Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 7/52 (13%) Query 1 GFSFF----ILINPLEESWQLCGAPGRTASCCCCCCCCCSTRIDAFRLRSKD 48 GFS F I N L E+ + CG RT CCCC C S +I +KD Sbjct 24 GFSDFRFTDIESNDLLEN-ENCGR--RTRLCCCCSCGNLSEKISGVYDDAKD 72 > At3g22550 Length=255 Score = 27.3 bits (59), Expect = 7.4, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 0/45 (0%) Query 1 GFSFFILINPLEESWQLCGAPGRTASCCCCCCCCCSTRIDAFRLR 45 G FF +P+ ES P SCCC C R D F R Sbjct 187 GVVFFRSSDPVNESDSDYSPPDSFLSCCCNCKKSLGPRDDIFMYR 231 Lambda K H 0.336 0.145 0.565 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1203243282 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40