bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6810_orf2 Length=130 Score E Sequences producing significant alignments: (Bits) Value Hs22052327 29.6 1.5 > Hs22052327 Length=379 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query 62 AVSAQAASVETGRTLICISSSR-VASLIAGGVAITAASRAAAAAATATAVTGAAAATAAA 120 A+ A+ V R++ CI + +SLI GG +T A+R +AA A A+ G A AA Sbjct 35 ALQAKWVQVVANRSVHCICDWKCFSSLIGGG--LTPATRMSAADKCAHALEGGARQDRAA 92 Lambda K H 0.314 0.120 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1246445644 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40