bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6810_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value Hs17444636 34.7 0.040 Hs20143964 28.9 2.3 > Hs17444636 Length=266 Score = 34.7 bits (78), Expect = 0.040, Method: Compositional matrix adjust. Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 16/90 (17%) Query 47 TLLLLMQMSVRPVSTEAAWADTAAPGA--LKGPVCP-----------QVRNW---LLLLQ 90 +++ + ++ V V+ E W D K P CP VR W L+L+ Sbjct 26 SVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVT 85 Query 91 CCSLRCTDSARWGGEREREQPAKHGEAAPA 120 C SL + ERER+ KHG AP+ Sbjct 86 CPSLLVVMHVAYREERERKHHLKHGPNAPS 115 > Hs20143964 Length=1115 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 0/33 (0%) Query 95 RCTDSARWGGEREREQPAKHGEAAPAHGGRFAG 127 R D +R G +R+ +P AP+ G R+ G Sbjct 67 RAPDDSRAGAQRDEPEPGTRRSPAPSPGARWLG 99 Lambda K H 0.319 0.128 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1209785478 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40