bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6634_orf4 Length=107 Score E Sequences producing significant alignments: (Bits) Value Hs7662222 29.3 1.9 CE17631 28.5 3.1 At5g65470 27.7 5.6 > Hs7662222 Length=1572 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query 40 WHRRRVSPVLLSLPLDKAPF--PAWLLALRLLLALLLLLSMSC 80 WHR+ S L +P+ + PF P++L L L + L++SC Sbjct 1374 WHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNISC 1416 > CE17631 Length=334 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 66 LRLLLALLLLLSMSCPACCASCPGGGRW 93 L+L + L+LL +S A C CP GG W Sbjct 41 LKLHVFFLVLLQISNAADCPICPTGGIW 68 > At5g65470 Length=523 Score = 27.7 bits (60), Expect = 5.6, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Query 18 GTGVEDRGSKSFAFAPVVAAASWHRRRVSPVLLS 51 GT V + K+ APV A+A+W+ VSPVL S Sbjct 190 GTAVRETRVKT---APVHASANWYIENVSPVLQS 220 Lambda K H 0.324 0.134 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40