bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6634_orf2 Length=111 Score E Sequences producing significant alignments: (Bits) Value Hs17484631 31.6 0.40 Hs4503655 31.2 0.53 At3g30810 29.6 1.6 Hs4557733 28.9 2.2 At3g06630 28.9 2.7 7300184 28.1 3.9 CE05450 28.1 4.0 7301415 27.7 5.1 SPBC1718.04 27.3 7.6 7293415 26.9 8.3 > Hs17484631 Length=699 Score = 31.6 bits (70), Expect = 0.40, Method: Compositional matrix adjust. Identities = 24/72 (33%), Positives = 29/72 (40%), Gaps = 12/72 (16%) Query 28 QQAGQLMLRSSNRARSNLRASSHAGNGALSRGSDSNTGETLRRCQ---EAAATTGAKAKL 84 +Q RSS + S L +SH G L RG RCQ E A A + Sbjct 411 KQGFNFANRSSEKCASQLPTASHVGKTYLGRGV---------RCQGGWETARKPNAPREA 461 Query 85 LLPLSSTPVPAT 96 L P+S P P T Sbjct 462 LFPISWWPFPPT 473 > Hs4503655 Length=1455 Score = 31.2 bits (69), Expect = 0.53, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 0/56 (0%) Query 46 RASSHAGNGALSRGSDSNTGETLRRCQEAAATTGAKAKLLLPLSSTPVPATFCCTL 101 R+ H+ N L G + + + R QE A + L++PL TP F + Sbjct 996 RSYDHSENSDLVFGGRTGNEDIISRLQEMVADLELQQDLIVPLGHTPSQEHFLFEI 1051 > At3g30810 Length=791 Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 8/61 (13%) Query 54 GALSRGSDSNTGETLRRCQEAAATTGAKAKLLLP---LSSTPVPATFCCTLCCLYSLLLP 110 G +R ++S+ + RRCQ T ++LP L VP +CC + +P Sbjct 65 GGGTRMTNSDLVDLRRRCQVPVGVT-----MILPRPPLHRENVPVGWCCAYANFFEKYMP 119 Query 111 E 111 E Sbjct 120 E 120 > Hs4557733 Length=1821 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 0/58 (0%) Query 1 TRTQDLTCDTSRRDSACLHLPPPGQLAQQAGQLMLRSSNRARSNLRASSHAGNGALSR 58 +R Q C + R + C + P + Q +L R NLR SS AG G L+R Sbjct 202 SRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWAERSPNLRRSSAAGEGTLAR 259 > At3g06630 Length=671 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 0/60 (0%) Query 21 PPPGQLAQQAGQLMLRSSNRARSNLRASSHAGNGALSRGSDSNTGETLRRCQEAAATTGA 80 P +A + L + SN+ RS +RA ++ G G+TL ++ AA++GA Sbjct 216 PIQVSIASKISSLASKLSNKVRSKMRAGDNSACGDSHHSDHDVFGDTLSDHRDDAASSGA 275 > 7300184 Length=544 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query 23 PGQLAQQAGQLMLRSSNRARSNLRASSHAGNGALSRGSDSNTGETL 68 P LAQ G +R+ R+ + +SH G+G + G D +GE + Sbjct 444 PRTLAQNCGANTIRALTALRA--KHASHTGDGVCAWGIDGESGEIV 487 > CE05450 Length=721 Score = 28.1 bits (61), Expect = 4.0, Method: Composition-based stats. Identities = 11/15 (73%), Positives = 13/15 (86%), Gaps = 0/15 (0%) Query 4 QDLTCDTSRRDSACL 18 QDL+CD S+R SACL Sbjct 416 QDLSCDFSKRASACL 430 > 7301415 Length=1270 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 84 LLLPLSSTPVPATFCCTLCCLYSLL 108 L+LP SST P T+C ++ C S L Sbjct 569 LILPASSTSAPVTYCSSVECTMSNL 593 > SPBC1718.04 Length=675 Score = 27.3 bits (59), Expect = 7.6, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 80 AKAKLLLPLSSTPVPATFCCTLCCLY 105 A KLL+ L TP+ +F LCC Y Sbjct 444 ATWKLLVALGMTPILYSFYALLCCYY 469 > 7293415 Length=4081 Score = 26.9 bits (58), Expect = 8.3, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 0/35 (0%) Query 46 RASSHAGNGALSRGSDSNTGETLRRCQEAAATTGA 80 RAS H N + S+ + S TG R TTGA Sbjct 118 RASKHRLNFSTSKSAGSGTGNKSRSASTTKITTGA 152 Lambda K H 0.317 0.127 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1192473466 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40