bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6626_orf2 Length=154 Score E Sequences producing significant alignments: (Bits) Value At1g41820 37.0 0.015 Hs22061809 28.5 6.0 > At1g41820 Length=401 Score = 37.0 bits (84), Expect = 0.015, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query 58 SFSAFPLVFISSSSSPLIVPFLFLFSFFGFRNPFPSFCSGVDSASAFLPFGLSGKRSAAS 117 +F+ FPLVF+ + P+ L + +GF NPF + S D A+ S A + Sbjct 248 TFNVFPLVFVKDNEKPVKDAILNIRKSYGFPNPF-DYGSKEDMDQAWSEMKASKASEART 306 Query 118 WLF 120 LF Sbjct 307 HLF 309 > Hs22061809 Length=324 Score = 28.5 bits (62), Expect = 6.0, Method: Compositional matrix adjust. Identities = 14/47 (29%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 92 PSFCSGVDSASAFLPFGLSGKRSAASWLFTSMAASEIIS-LNNSLVL 137 P++ +++ ++FL G+ G +S+ WL S++A II+ L N++++ Sbjct 4 PAYNHTMETPASFLLVGIPGLQSSHLWLAISLSAMYIIALLGNTIIV 50 Lambda K H 0.335 0.143 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1997677330 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40