bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6532_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value Hs17511218 28.9 2.2 Hs18603787 28.9 2.2 7293618 28.1 3.9 At3g57260 27.3 6.8 > Hs17511218 Length=485 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 0/24 (0%) Query 37 SSIHPCLSVILKVAGRASNYNYTC 60 S H CLS + ++ G + N+ YTC Sbjct 34 SFCHSCLSGLWEIPGESQNWGYTC 57 > Hs18603787 Length=485 Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 0/24 (0%) Query 37 SSIHPCLSVILKVAGRASNYNYTC 60 S H CLS + ++ G + N+ YTC Sbjct 34 SFCHSCLSGLWEIPGESQNWGYTC 57 > 7293618 Length=2006 Score = 28.1 bits (61), Expect = 3.9, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query 39 IHP-CLSVILKVAGRASNYNYTCWSGNC 65 +HP C+ + ++ GR NYN+ C C Sbjct 1723 VHPSCVDMPPRMVGRVRNYNWQCAGCKC 1750 > At3g57260 Length=339 Score = 27.3 bits (59), Expect = 6.8, Method: Compositional matrix adjust. Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 10/77 (12%) Query 41 PCLSVILKVAGRASNYNYTCWS-GNCSRRLGRTTDSPSYLAAAFSGILPVRLRIKRPD-- 97 P L ++L + AS +N+T G C LG T SPS + A + R+R+ PD Sbjct 11 PMLMILLSLV-IASFFNHTAGQIGVCYGMLGDTLPSPSDVVALYKQQNIQRMRLYGPDPG 69 Query 98 ------DQQVLLLLDHP 108 + L+LD P Sbjct 70 ALAALRGSDIELILDVP 86 Lambda K H 0.320 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187579072 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40