bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6477_orf4 Length=62 Score E Sequences producing significant alignments: (Bits) Value CE03988 30.8 0.60 SPCC1450.11c 27.3 7.2 > CE03988 Length=623 Score = 30.8 bits (68), Expect = 0.60, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 0/43 (0%) Query 10 ATFRELNHLSSRLTPAPSFPNELPSNHAPICSFHPTQITHTQR 52 + +E L RL A S PN L ++ CSFH ++ R Sbjct 117 SVLKENQELKKRLAEAESVPNSLATSRNGDCSFHVAELEQKLR 159 > SPCC1450.11c Length=1338 Score = 27.3 bits (59), Expect = 7.2, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 0/36 (0%) Query 15 LNHLSSRLTPAPSFPNELPSNHAPICSFHPTQITHT 50 L HL S+L P+ +FP+ + A C P T+T Sbjct 419 LGHLESKLAPSITFPDACDALEAEECITRPGSATNT 454 Lambda K H 0.321 0.130 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40