bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6477_orf1 Length=58 Score E Sequences producing significant alignments: (Bits) Value At3g02930 32.7 0.15 CE04656 28.9 2.5 At5g37510 27.7 5.0 Hs22057043 27.3 7.8 > At3g02930 Length=806 Score = 32.7 bits (73), Expect = 0.15, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 10/53 (18%) Query 5 PR-THLLLPPNSNYPYATLLSQPHHHTQPSANHKPS---------TPPSPTQI 47 PR T ++ P+SN P T +PS+N KPS TPP TQI Sbjct 25 PRLTRIVTKPDSNSPSPTQQQSRLSFERPSSNSKPSTDKRSPKAPTPPEKTQI 77 > CE04656 Length=569 Score = 28.9 bits (63), Expect = 2.5, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Query 8 HLLLPPNSNYPYATLLSQPHHHTQPSANHKP---STPPSPTQISTRLRT 53 ++LLP + P ++++ HH T + +P S PPS ++ L T Sbjct 505 YVLLPETRDRPMVEIVTEVHHRTASLSAGRPWDASRPPSRQEVQRLLDT 553 > At5g37510 Length=745 Score = 27.7 bits (60), Expect = 5.0, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query 2 SVQPRTHLLLPPNSNYPYATLLSQPHHHTQPSANHKPSTPPSPTQI 47 +++P + LL SN+ T++S+P + SA S P PTQI Sbjct 10 TIRPASRLLQSQTSNFFLRTIVSKPELQSPESA--AVSEPEPPTQI 53 > Hs22057043 Length=434 Score = 27.3 bits (59), Expect = 7.8, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query 9 LLLPPNSNYPYATLLSQPHH-HTQPSANHKPSTPPSPTQIST 49 + LPPN+ PY LLS P A++ S+ PSP +ST Sbjct 242 IQLPPNAGIPYTQLLSSMQGPKATPWAHNSASSCPSPILLST 283 Lambda K H 0.311 0.122 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187999082 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40